DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and NEGR1

DIOPT Version :10

Sequence 1:NP_731670.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:260 Identity:68/260 - (26%)
Similarity:105/260 - (40%) Gaps:65/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 NITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIK 478
            |:..:.|:.|.:.|.:...:.|. :|  :..:.||......:..|.|.........||  ||||:
Human    47 NMMVRKGDTAVLRCYLEDGASKG-AW--LNRSSIIFAGGDKWSVDPRVSISTLNKRDY--SLQIQ 106

  Fly   479 YVEPSDAGWYECQMATE--PKLSAKVHLQI-VKPKT-ELIGDQSRFVKAGSKVALHCIVRGTLDP 539
            .|:.:|.|.|.|.:.|:  |: :.:|||.: |.||. ::..|.:  |..|:.|.|.|:..|..:|
Human   107 NVDVTDDGPYTCSVQTQHTPR-TMQVHLTVQVPPKIYDISNDMT--VNEGTNVTLTCLATGKPEP 168

  Fly   540 PKYIIWFRGQKKISDSDE--RTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSN 602
            .  |.|    :.||.|.:  ..|.|  ||  |:|                :.::.:|.|.|...|
Human   169 S--ISW----RHISPSAKPFENGQY--LD--IYG----------------ITRDQAGEYECSAEN 207

  Fly   603 SVS------VSVDLHVLSGEYSASAIMSTAARTTKGGRSTCHSTLGLLGILGLLWAMQGAMHTPP 661
            .||      |.|.::.      |..|....:.|...|||            ||: ..:||...||
Human   208 DVSFPDVRKVKVVVNF------APTIQEIKSGTVTPGRS------------GLI-RCEGAGVPPP 253

  Fly   662  661
            Human   254  253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_731670.1 V-set 415..507 CDD:462230 25/94 (27%)
IG_like 521..612 CDD:214653 26/98 (27%)
Ig strand B 527..531 CDD:409353 2/3 (67%)
Ig strand C 542..546 CDD:409353 1/3 (33%)
Ig strand E 581..585 CDD:409353 0/3 (0%)
Ig strand F 595..600 CDD:409353 2/4 (50%)
NEGR1NP_776169.2 IG_like 47..135 CDD:214653 26/93 (28%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 68..72 CDD:409353 2/6 (33%)
Ig strand E 101..105 CDD:409353 3/5 (60%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig_3 138..207 CDD:464046 24/96 (25%)
IG_like 231..312 CDD:214653 10/36 (28%)
Ig strand B 241..245 CDD:409353 2/4 (50%)
Ig strand C 254..258 CDD:409353 68/260 (26%)
Ig strand E 280..284 CDD:409353
Ig strand F 294..299 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.