DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and zig-10

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001122644.1 Gene:zig-10 / 188896 WormBaseID:WBGene00020800 Length:322 Species:Caenorhabditis elegans


Alignment Length:124 Identity:35/124 - (28%)
Similarity:46/124 - (37%) Gaps:49/124 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 LSAKVH-LQIVKPKTELIGDQSRFVKAGSKVALHCIVRGTLDP--PKYIIWFRGQKKISDSDERT 559
            ||..:| |...|..||      |.|..||..||.|      :|  ...:.|:|            
 Worm    18 LSETIHTLAPKKAPTE------RLVPIGSTTALEC------EPYTSSNVTWYR------------ 58

  Fly   560 GWYTQLDRNIFGTVGDNQNT----------------IGSLIIPLVRKEDSGNYTCQPSN 602
                  |:::..||..::|.                ||.|:|..|:|||.|||.||..|
 Worm    59 ------DKHVIATVEGHKNAILNERKPRGGEERIPEIGFLVIFDVQKEDEGNYYCQREN 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653
Ig 415..507 CDD:299845 4/9 (44%)
IG_like 521..612 CDD:214653 27/100 (27%)
IGc2 524..605 CDD:197706 26/97 (27%)
zig-10NP_001122644.1 IG_like 31..118 CDD:214653 30/111 (27%)
IGc2 38..111 CDD:197706 25/96 (26%)
IG_like 143..215 CDD:214653
IGc2 145..209 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.