DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and zig-10

DIOPT Version :10

Sequence 1:NP_731670.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001122644.1 Gene:zig-10 / 188896 WormBaseID:WBGene00020800 Length:322 Species:Caenorhabditis elegans


Alignment Length:124 Identity:35/124 - (28%)
Similarity:46/124 - (37%) Gaps:49/124 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 LSAKVH-LQIVKPKTELIGDQSRFVKAGSKVALHCIVRGTLDP--PKYIIWFRGQKKISDSDERT 559
            ||..:| |...|..||      |.|..||..||.|      :|  ...:.|:|            
 Worm    18 LSETIHTLAPKKAPTE------RLVPIGSTTALEC------EPYTSSNVTWYR------------ 58

  Fly   560 GWYTQLDRNIFGTVGDNQNT----------------IGSLIIPLVRKEDSGNYTCQPSN 602
                  |:::..||..::|.                ||.|:|..|:|||.|||.||..|
 Worm    59 ------DKHVIATVEGHKNAILNERKPRGGEERIPEIGFLVIFDVQKEDEGNYYCQREN 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_731670.1 V-set 415..507 CDD:462230 4/9 (44%)
IG_like 521..612 CDD:214653 27/100 (27%)
Ig strand B 527..531 CDD:409353 2/3 (67%)
Ig strand C 542..546 CDD:409353 0/3 (0%)
Ig strand E 581..585 CDD:409353 2/3 (67%)
Ig strand F 595..600 CDD:409353 3/4 (75%)
zig-10NP_001122644.1 IG_like 31..118 CDD:214653 30/111 (27%)
Ig strand B 42..46 CDD:409353 2/3 (67%)
Ig strand C 53..57 CDD:409353 0/3 (0%)
Ig strand E 91..94 CDD:409353 1/2 (50%)
Ig strand F 104..109 CDD:409353 3/4 (75%)
Ig_3 134..206 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.