DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and zig-4

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:144 Identity:29/144 - (20%)
Similarity:50/144 - (34%) Gaps:41/144 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   475 LQIKYVEPSDAGWYEC---------QMATEPKLSAKV------HLQIVKPKTELI-GDQSRFVKA 523
            |.|:.....::|.|.|         :...|.::..:.      |    |...|:: ...|||...
 Worm   115 LTIQCPSAENSGTYSCVGYNGHQTIETVAEVEI
EGEASGCRSNH----KSAPEIVFWTDSRFEMT 175

  Fly   524 GSKVALHCIVRGTLDPPKYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLV 588
            |:...|.|.....:|    .:|....:.:.::|:    :|.|..             |.|:|..:
 Worm   176 GNVATLVCRANQQVD----WVWMSNDELVKNNDK----FTVLSN-------------GDLVIKNI 219

  Fly   589 RKEDSGNYTCQPSN 602
            ..:|.|.|||...|
 Worm   220 VWDDMGTYTCIARN 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 5/24 (21%)
Ig 415..507 CDD:299845 7/46 (15%)
IG_like 521..612 CDD:214653 17/82 (21%)
IGc2 524..605 CDD:197706 17/79 (22%)
zig-4NP_509335.1 I-set 47..147 CDD:254352 6/31 (19%)
Ig 65..144 CDD:143165 5/28 (18%)
IG_like 176..245 CDD:214653 17/79 (22%)
Ig <193..238 CDD:299845 13/58 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.