DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and zig-8

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:251 Identity:58/251 - (23%)
Similarity:104/251 - (41%) Gaps:49/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 GDGAGSAVR----------RNLTMPVLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVD 451
            |.||...|.          .|.:..::|:.|:  |.||:.|.:...::..::|.|:.|..:::..
 Worm    19 GHGASEEVMACLRQERSRVENPSQTIVNVVAE--NPAYLHCSVPPDAEHEIAWTRVSDGALLTAG 81

  Fly   452 ETTFIADERFQSIYQEDHDYTWSLQIKYVEPSDAGWYECQMATEPKLSAKVHLQIVKP------- 509
            ..||..|.|:|  ..:.....|.|.::..|..|:|.|.|::..:......|:|::::|       
 Worm    82 NRTFTRDPRWQ--VSKKSANIWVLNLRRAEQQDSGCYLCEINDKHNTVYAVYLKVLEPPLPSPSS 144

  Fly   510 ----KTELIGDQSRFVKAGSKVALHCIVRGT------LDPPKYIIWFRGQKKISDSDERTGWYTQ 564
                .|:|:.:.|     |.:|.|:|.|..|      ||    ::|.|....|:.:|        
 Worm   145 LQKKSTKLMANMS-----GDEVVLNCTVTSTDKDEEVLD----VVWTRDGNTINFND-------- 192

  Fly   565 LDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSNSVSVSVDLHVLSGEYSAS 620
            .::.|.....|....|.::.|.....||.|||.|:.|...:..: :|:...|...|
 Worm   193 TEKYILKVKRDAGVVIETMRIRKATMEDDGNYACEHSQQKASQI-VHINKAEAQTS 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 20/76 (26%)
Ig 415..507 CDD:299845 22/91 (24%)
IG_like 521..612 CDD:214653 23/96 (24%)
IGc2 524..605 CDD:197706 23/86 (27%)
zig-8NP_499714.1 IG_like 55..134 CDD:214653 18/80 (23%)
Ig 55..129 CDD:143165 16/75 (21%)
ig 158..229 CDD:278476 22/82 (27%)
IG_like 158..227 CDD:214653 21/80 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I7153
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.