DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and rig-5

DIOPT Version :10

Sequence 1:NP_731670.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:198 Identity:51/198 - (25%)
Similarity:85/198 - (42%) Gaps:31/198 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 AQMGNHAYMPCQIHRLSDKPVSWVRMRDN--HIISVDETTFIADERFQ------SIYQEDHDYTW 473
            |.:|......|.::.|....|::|: .|:  .::|.||..|....:::      .::.|     |
 Worm    96 ALLGQDVDFTCIVNDLGSHMVAFVK-ADSPPRLLSFDEKVFRRRNKYELKPRIGDLHNE-----W 154

  Fly   474 SLQIKYVEPSDAGWYECQMATEPKLSAKVHLQI-VKPKTELIGDQSRFVKAGSKVALHCIVRGTL 537
            .|.||.|:.||.|.|.||:.|||...:...|.: |.|........:..|:.|:.|:|.|...|  
 Worm   155 VLTIKNVQESDRGNYSCQINTEPITLSTGELDVKV
PPVVSRSTPAAVEVREGNNVSLTCKADG-- 217

  Fly   538 DPPKYIIWFRGQKKISDSDERTGWYTQLDRNIF-GTVGDNQNTIGSLIIPLVRKEDSGNYTCQPS 601
            :|...:||.|..::|...:..||:    ..::| |.|         |.:..|.::....|.|..|
 Worm   218 NPTPTVIWRRQDRQIIRYNGATGF----GASVFHGPV---------LHLTKVSRKHMSEYLCVAS 269

  Fly   602 NSV 604
            |.:
 Worm   270 NGI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_731670.1 V-set 415..507 CDD:462230 27/98 (28%)
IG_like 521..612 CDD:214653 22/85 (26%)
Ig strand B 527..531 CDD:409353 2/3 (67%)
Ig strand C 542..546 CDD:409353 1/3 (33%)
Ig strand E 581..585 CDD:409353 1/3 (33%)
Ig strand F 595..600 CDD:409353 2/4 (50%)
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 27/98 (28%)
Ig strand B 102..106 CDD:409353 0/3 (0%)
Ig strand C 118..122 CDD:409353 1/4 (25%)
Ig strand E 154..158 CDD:409353 2/3 (67%)
Ig strand F 168..173 CDD:409353 2/4 (50%)
Ig_3 190..270 CDD:464046 21/94 (22%)
Ig_3 287..369 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.