DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and nitr1d

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_938163.1 Gene:nitr1d / 170990 ZFINID:ZDB-GENE-020225-11 Length:324 Species:Danio rerio


Alignment Length:206 Identity:46/206 - (22%)
Similarity:71/206 - (34%) Gaps:54/206 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 CQIHRLSDKPVSWVRMRDN----HIISVDET-------TFIADERFQSIYQEDHDYTWSLQIKYV 480
            |....|.....:|.:..:|    .|:|:.|:       .|....||.   ....|:.::|.|...
Zfish    40 CTFPWLVQSTKAWFKQANNGKSLQIVSLYESQKPSWNHNFEKTNRFN---VNKGDFYFNLTIVKT 101

  Fly   481 EPSDAGWYEC--------QMATEPKL---------SAKVHLQIVKPKTELIGDQSRFVKAGSKVA 528
            :|||:..|.|        .|.:..:|         :..:|..::..           |..|..|.
Zfish   102 KPSDSATYYCVVSSYQATGMGSGTRLLVR
DEAADRNTTLHQSLIDA-----------VDPGDSVH 155

  Fly   529 LHC-IVRGTLDPPKYIIWFRGQKKISDSDERTGWYTQLDRNIFG-----TVGDNQNTIGSLIIPL 587
            |.| |...:......:.||    |.|..|.....||:.:||  |     |....|:.:.||....
Zfish   156 LQCSIFTESCAGDHRVYWF----KQSSGDSEGVLYTKGERN--GRCKNSTESQTQSCVYSLHKNN 214

  Fly   588 VRKEDSGNYTC 598
            :.:.|||.|.|
Zfish   215 ISRSDSGIYYC 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 18/82 (22%)
Ig 415..507 CDD:299845 21/107 (20%)
IG_like 521..612 CDD:214653 25/84 (30%)
IGc2 524..605 CDD:197706 24/81 (30%)
nitr1dNP_938163.1 Ig 35..130 CDD:299845 20/92 (22%)
IG_like 59..129 CDD:214653 16/72 (22%)
IG_like 148..227 CDD:214653 25/84 (30%)
V-set 150..243 CDD:284989 24/82 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.