DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and nitr1l

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_938161.2 Gene:nitr1l / 170986 ZFINID:ZDB-GENE-020225-7 Length:316 Species:Danio rerio


Alignment Length:232 Identity:50/232 - (21%)
Similarity:87/232 - (37%) Gaps:34/232 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 AQMGNHAYMPCQIHRLSDKPVSWVRM----RDNHIISVDETTFIADERFQSIYQEDH------DY 471
            |..|....:.|...||.....:|.:.    :...|:|:    :...:...|...|:|      |.
Zfish    30 AAAGEEVNLTCTFIRLVQATKAWFKQTADGKSLQIVSL----YSNGKPVWSNISENHFNVMKGDG 90

  Fly   472 TWSLQIKYVEPSDAGWYECQMATEPKL----SAKVHLQIVKPKTELIGDQSRFVKAGSKVALHC- 531
            .::|.|...:|||:..|.|.::|....    ..::.::.....|.|.......|..|..|.|.| 
Zfish    91 YFNLTILKTKPSDSATYYCVISTFYTFGMGSGTRLLVRAADRNTTLHQSLIDTVDPGDSVNLQCS 155

  Fly   532 IVRGTLDPPKYIIWFRGQKKISDSDERTGWYTQLDRNIFG-----TVGDNQNTIGSLIIPLVRKE 591
            |...:.:....|.||    |.|..|.....||:.:||  |     |....|:.:.||....:.:.
Zfish   156 IFTESCEGDHSIYWF----KQSSGDSEGVLYTKGERN--GRCKDSTESQTQSCVYSLHKNNISRS 214

  Fly   592 DSGNYTCQPSNSVSVSV----DLHVLSGEYSASAIMS 624
            |||.|.|..:....:.:    .|::...:::.:.:.|
Zfish   215 DSGIYYCAVATCGQILIGRGTQLNIRESDFNPALLAS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 18/83 (22%)
Ig 415..507 CDD:299845 20/103 (19%)
IG_like 521..612 CDD:214653 27/100 (27%)
IGc2 524..605 CDD:197706 25/86 (29%)
nitr1lNP_938161.2 V-set 30..128 CDD:311561 20/101 (20%)
V-set 143..240 CDD:311561 27/102 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.