DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and LOC101885194

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_009301267.1 Gene:LOC101885194 / 101885194 -ID:- Length:187 Species:Danio rerio


Alignment Length:140 Identity:32/140 - (22%)
Similarity:51/140 - (36%) Gaps:34/140 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 DQSRFVKAGSKVALHCI-----------VRGTLD-PPKYIIWFRGQKKISDSDERTGWYTQLDR- 567
            |..:.||||..|...|.           ::.|.| ..:.|:...|.:|.|       |..:.:. 
Zfish    25 DNVKIVKAGWDVKFTCTFSWQIQLTKAWIKHTTDGKSQQIVSLYGSQKPS-------WNPKFENT 82

  Fly   568 NIFGT-VGDNQNTIGSLIIPLVRKEDSGNYTCQPSNSVSVSVDLHVLSGEYSASAIMSTAARTTK 631
            |.|.. .|||   ..:|.|......||..|.|..|:        :..:|..|.:.::...:.|.:
Zfish    83 NRFNADKGDN---FFNLTILKTTLSDSATYYCVVSS--------YQATGLVSGTRLLVRDSATDR 136

  Fly   632 GGRSTCHSTL 641
              .:|.|.:|
Zfish   137 --NTTLHQSL 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653
Ig 415..507 CDD:299845
IG_like 521..612 CDD:214653 25/104 (24%)
IGc2 524..605 CDD:197706 22/94 (23%)
LOC101885194XP_009301267.1 V-set 30..130 CDD:284989 27/117 (23%)
IG_like 30..129 CDD:214653 27/116 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.