DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and LOC100909964

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_008767726.1 Gene:LOC100909964 / 100909964 RGDID:6500592 Length:308 Species:Rattus norvegicus


Alignment Length:249 Identity:54/249 - (21%)
Similarity:81/249 - (32%) Gaps:92/249 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 GNHAYMPCQIHRLSD-KPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDY------------ 471
            |....:.|.:..|:. .|..|.:..              .:..|.||....||            
  Rat    45 GGSVILNCTVTSLTPVGPTRWFKGE--------------GQNRQLIYSFRGDYFPRITNIADVTK 95

  Fly   472 ----TWSLQIKYVEPSDAGWYEC---QMAT-EPKLSAK--------------VHLQIVKPKTELI 514
                .:|::|..:..:|||.|.|   |..| ||.:..:              ..|::|:|: :||
  Rat    96 RNNTDFSIRISNIMLADAGTYYCVKFQKGTVEPDIEIQSGGGTELFVYGADMKKLKVVQPE-KLI 159

  Fly   515 GDQSRFVKAGSKVALHCIVRGTLDPPKYIIWFRGQK------------------KISDSDERTGW 561
            .     |.||..|.|:|.|...: |...|.||||.:                  .:|||.:|   
  Rat   160 S-----VDAGESVTLNCTVTSII-PMGPIKWFRGAQHSRHLIFNFTGGYFPRVTNVSDSSKR--- 215

  Fly   562 YTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSNSVSVSVDLHVLSG 615
                           .|...|:.|..|...|:|.|.|.......:..|:.:.||
  Rat   216 ---------------NNLDFSIRISNVMPADAGTYYCVKFQKELLETDIEIQSG 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 17/90 (19%)
Ig 415..507 CDD:299845 22/121 (18%)
IG_like 521..612 CDD:214653 26/108 (24%)
IGc2 524..605 CDD:197706 23/98 (23%)
LOC100909964XP_008767726.1 V-set 35..142 CDD:284989 21/110 (19%)
IG_like 40..142 CDD:214653 21/110 (19%)
V-set 154..261 CDD:284989 31/126 (25%)
IG_like 159..238 CDD:214653 25/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.