DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and ntm

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_004916061.1 Gene:ntm / 100492453 XenbaseID:XB-GENE-6045425 Length:374 Species:Xenopus tropicalis


Alignment Length:366 Identity:78/366 - (21%)
Similarity:118/366 - (32%) Gaps:153/366 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 NITAQMGNHAYMPCQIHRLSDKPVSW-----VRMRDNHIISVD-ETTFIADERFQSIYQEDHDYT 472
            |:|.:.|:.|.:.|.:.....: |:|     :....|...|:| ....:|:.:.|          
 Frog    45 NVTVRQGDSAILRCTVDNRVTR-VAWLNRSTILYTGNDKWSIDPRVVLLANTKSQ---------- 98

  Fly   473 WSLQIKYVEPSDAGWYECQMATE--PKLSAKVHLQIVKPKTELIGDQSRFVKAGSKVALHCIVRG 535
            :|::|:.|:..|.|.|.|.:.|:  ||.| :|||.:..|...:....|..|..||.|:|.||..|
 Frog    99 YSIEIQNVDIYDEGPYTCSVQTDNHPKTS-RVHLIVQVPPRIVDISSSIAVNEGSNVSLICIANG 162

  Fly   536 TLDP--------------------------------------------------------PKYII 544
            ..:|                                                        |.||:
 Frog   163 RPEPVVNWRYLSPKARGFVSEDEYLEITGITREQSGIYECSASNDVSAPDVRRVKLTVNYPPYIL 227

  Fly   545 ----------------------------WFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIG 581
                                        |::..|::|||     |.        |...:|:.||.
 Frog   228 DAQNIGAPLGHRGILQCEASAVPAADFFWYKEDKRLSDS-----WR--------GVKVENRETIS 279

  Fly   582 SLIIPLVRKEDSGNYTCQPSNSVSVSVDLHVLSGEYSASAIM---------------STAARTTK 631
            .:....|.::|.|||||...|          |.|..:||.|:               ||||.|..
 Frog   280 RVTFLNVSEQDYGNYTCMAKN----------LLGHSNASIILFELFQSTSSPLLQEESTAALTPL 334

  Fly   632 GGRSTCHSTLGLLG---------ILGLLWAMQGAMHTPPTQ 663
            .|....|.  |..|         :|.||..:..::..||.|
 Frog   335 KGPGAVHD--GNSGSTQCSFCAPLLILLLLLPFSLLLPPAQ 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 18/82 (22%)
Ig 415..507 CDD:299845 25/99 (25%)
IG_like 521..612 CDD:214653 30/174 (17%)
IGc2 524..605 CDD:197706 29/164 (18%)
ntmXP_004916061.1 Ig 45..133 CDD:299845 26/99 (26%)
IG_like 45..133 CDD:214653 26/99 (26%)
IG_like 143..220 CDD:214653 10/76 (13%)
IGc2 150..209 CDD:197706 8/58 (14%)
ig 227..311 CDD:278476 22/106 (21%)
IG_like 230..311 CDD:214653 22/103 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.