Sequence 1: | NP_001287297.1 | Gene: | dpr17 / 41470 | FlyBaseID: | FBgn0051361 | Length: | 664 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002938252.1 | Gene: | iglon5 / 100488314 | XenbaseID: | XB-GENE-945713 | Length: | 333 | Species: | Xenopus tropicalis |
Alignment Length: | 199 | Identity: | 55/199 - (27%) |
---|---|---|---|
Similarity: | 88/199 - (44%) | Gaps: | 36/199 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 411 PVLNITAQMGNHAYMPCQIHRLSDK--PVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTW 473
Fly 474 SLQIKYVEPSDAGWYECQMATEPK-LSAKVHLQIVKPKTELIGDQSRFVKAGSKVALHCIVRGTL 537
Fly 538 DPPKYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSN 602
Fly 603 SVSV 606 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr17 | NP_001287297.1 | IG_like | 414..491 | CDD:214653 | 23/78 (29%) |
Ig | 415..507 | CDD:299845 | 28/94 (30%) | ||
IG_like | 521..612 | CDD:214653 | 23/86 (27%) | ||
IGc2 | 524..605 | CDD:197706 | 19/80 (24%) | ||
iglon5 | XP_002938252.1 | Ig | 31..123 | CDD:299845 | 30/97 (31%) |
IG_like | 35..123 | CDD:214653 | 29/94 (31%) | ||
Ig | 126..207 | CDD:299845 | 25/98 (26%) | ||
I-set | 128..207 | CDD:254352 | 24/96 (25%) | ||
I-set | 210..299 | CDD:254352 | |||
Ig | 227..298 | CDD:143165 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |