DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and Sirpd

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_017446697.1 Gene:Sirpd / 100360722 RGDID:2321536 Length:308 Species:Rattus norvegicus


Alignment Length:242 Identity:61/242 - (25%)
Similarity:86/242 - (35%) Gaps:60/242 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 PVLNITAQMGNHAYMPCQIHRLSD-KPVSWVR--MRDNHIISVDETTFIADERFQSIYQEDHDYT 472
            |..::....|....:.|.:..|:. .|:.|.|  ....|:|     .:.....|..|.... |.|
  Rat    36 PKKSVCVDAGGSVTLNCTVTSLTPVGPIKWFRGVGHSRHLI-----YYFTGYHFSRITNAS-DAT 94

  Fly   473 ------WSLQIKYVEPSDAGWYEC----QMATEP----------KLSAKV----HLQIVKPKTEL 513
                  :|:.|..|.|:|||.|.|    :...||          :||..|    .|::.:||   
  Rat    95 KRGNLDFSIHISNVTPADAGTYYCVKFQKGIVEPDIEIQSGGGTELSVFVADMKELKVFQPK--- 156

  Fly   514 IGDQSRFVKAGSKVALHCIVRGTLDPPKYIIWFRGQKKISDSDERTGWYTQLDRNIFG------T 572
               :|..|.||..|.|:|.|. :|.|...|.|:||          .|....|..|..|      |
  Rat   157 ---KSVCVDAGGSVTLNCTVT-SLTPVGPIKWYRG----------VGHNRHLIYNFTGYRFPRVT 207

  Fly   573 VGDNQNTIG----SLIIPLVRKEDSGNYTCQPSNSVSVSVDLHVLSG 615
            ...:....|    |:.|..|...|:|.|.|.......|..|:.:.||
  Rat   208 NASDATKRGNLDFSIHISNVTPADAGTYYCVKFQKGIVEPDIEIQSG 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 21/89 (24%)
Ig 415..507 CDD:299845 27/118 (23%)
IG_like 521..612 CDD:214653 28/100 (28%)
IGc2 524..605 CDD:197706 24/90 (27%)
SirpdXP_017446697.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.