DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and nitr5

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001135740.1 Gene:nitr5 / 100216319 ZFINID:ZDB-GENE-020225-40 Length:337 Species:Danio rerio


Alignment Length:259 Identity:47/259 - (18%)
Similarity:87/259 - (33%) Gaps:82/259 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 NLTMPVLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADE-------RFQSI 464
            |:..|...::.|.|..|.:.|.|.........|.:.     ::.:|...||..       :|.:.
Zfish    22 NIIQPDTVVSFQEGETAVLRCFITNSQMSMTLWYKQ-----VTGEEPRLIASSILRSSEIQFHNE 81

  Fly   465 YQEDHDYT------WSLQIKYVEPSDAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQSRFVKA 523
            :...|...      ::|:|.....||:|.|.|..:.                       |..::.
Zfish    82 FDSSHFEVLRDTGGFNLKIVNAVQSDSGTYYCATSF-----------------------SNVIEF 123

  Fly   524 GSKVALHCIVRGT-LDPPKYI--------------IWFRGQKKISDSDERTGWYTQLDR------ 567
            |:...|  :|:|| |:.|.|:              :....|.::..::.|..|::....      
Zfish   124 GNGTRL--VVKGTNLNKPTYLQLHELEQVESAKNPLLCSVQNQLVRNEHRLYWFSHGSEESPPGF 186

  Fly   568 -NIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQ----PSNSVSVSVDLHVLSGEYSASAIMSTA 626
             :|:|  ..:::.:||      .|.|..:.||.    ...|.|..:::|     |.|.|....|
Zfish   187 IHIYG--NSSKSCVGS------SKSDCLSPTCMYNLPMKRSRSSEMEMH-----YCALATCGQA 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 17/89 (19%)
Ig 415..507 CDD:299845 18/104 (17%)
IG_like 521..612 CDD:214653 21/116 (18%)
IGc2 524..605 CDD:197706 20/106 (19%)
nitr5NP_001135740.1 Ig 23..132 CDD:299845 22/138 (16%)
IG_like 29..131 CDD:214653 21/131 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.