DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and kirrel1b

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_017212964.1 Gene:kirrel1b / 100170816 ZFINID:ZDB-GENE-070912-173 Length:801 Species:Danio rerio


Alignment Length:235 Identity:56/235 - (23%)
Similarity:93/235 - (39%) Gaps:54/235 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 SWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKYVEPSDAGWYECQMATEPKL-SAK 501
            :|.|.|...|:.|.:                    ::|:|...:.:|...|||| |||..| |.:
Zfish    72 AWPRYRVLRIMDVGQ--------------------YNLEITSADLTDDSLYECQ-ATEAALRSRR 115

  Fly   502 VHLQIVKPKTELI--GDQSRFVKAGSKVALHCIVRGTLDPPKYIIWFRGQKKISDSDERTGWYTQ 564
            ..|.::.|....:  |.....:.||:...|.|:.||. .|...|.|::      |.....|.:|.
Zfish   116 AKLTVLIPPDGPVIEGSPEILLTAGTSFNLTCVSRGA-KPMSTIEWYK------DGIIVEGAHTS 173

  Fly   565 LDRNIFGTVGDNQN-TIGSLIIPLVRKEDSG-NYTCQPSNSV-------SVSVDLHVLSGEYSAS 620
            .:     .:.|.:. |..|.:.......|:| |:||..||..       :|::::|     :..:
Zfish   174 TE-----VLSDRKRVTTKSFLEIQPMDTDTGRNFTCVASNLAAPLGKRSTVTLNIH-----HPPT 228

  Fly   621 AIMSTAARTTKGG---RSTCHSTLGLLGILGLLWAMQGAM 657
            .|:|...|:...|   :.||.:|.. ..|:|..||..|.:
Zfish   229 VILSIEPRSVLEGERVKFTCQATAN-PPIMGYRWAKGGVI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 10/52 (19%)
Ig 415..507 CDD:299845 18/69 (26%)
IG_like 521..612 CDD:214653 23/99 (23%)
IGc2 524..605 CDD:197706 21/89 (24%)
kirrel1bXP_017212964.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.