DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and lrit3b

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_009305418.1 Gene:lrit3b / 100144406 ZFINID:ZDB-GENE-070424-130 Length:487 Species:Danio rerio


Alignment Length:258 Identity:53/258 - (20%)
Similarity:94/258 - (36%) Gaps:56/258 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 MPVLNITAQMGNHAYMPCQIHRLS----DKPVSWVRMRDNH-----IISVDETTFIADERFQSIY 465
            :|:|.: ..:.|..|:....:|||    |....|:....|.     ::.:.:..::.|.|..::.
Zfish   175 IPLLAV-RYLRNVTYLDLSSNRLSTLANDLTALWLFSDSNQTQRSFVLGLQDNPWVCDCRLSTLL 238

  Fly   466 QEDHDYTWSLQI--KYV---EPSDAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQSRFVKAGS 525
            ........||.:  :::   ||.|......|..   :||......:|...|::.      ...||
Zfish   239 DISRGPESSLVLLDRFLTCSEPLDLAGVPFQSV---ELSRCRRPYVVTSATKIT------ALLGS 294

  Fly   526 KVALHCIVRGTLDPPKYIIWFRGQKKISDSDERTGWYTQ---------LD-----RNIFGTVGDN 576
            .|.|.|...|  .|...::|.:..|:        ..|.|         ||     :.:||.|.::
Zfish   295 TVLLRCEATG--HPTPALMWIKSAKR--------NLYNQGCCKQTQSSLDTERFPKKLFGYVQES 349

  Fly   577 QNT-IGSLIIPL--VRKEDSGNYTCQPSNSVSVS---VDLHVLS--GEYSASAIMSTAARTTK 631
            ... :...::.|  :...|:|.|.|:..|...:|   |.|:|:.  .||:..........|||
Zfish   350 PRVGVRWSVVSLNGISYSDAGEYRCRAQNMAGISEAVVSLNVVGVMAEYTDFKNSDQQQTTTK 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 15/90 (17%)
Ig 415..507 CDD:299845 18/105 (17%)
IG_like 521..612 CDD:214653 25/110 (23%)
IGc2 524..605 CDD:197706 22/97 (23%)
lrit3bXP_009305418.1 LRRNT 51..92 CDD:214470
leucine-rich repeat 69..89 CDD:275380
LRR_8 112..172 CDD:290566
leucine-rich repeat 114..137 CDD:275378
leucine-rich repeat 138..161 CDD:275378
LRR_8 160..214 CDD:290566 9/39 (23%)
LRR_4 160..201 CDD:289563 7/26 (27%)
leucine-rich repeat 162..185 CDD:275378 2/10 (20%)
leucine-rich repeat 186..199 CDD:275378 4/12 (33%)
leucine-rich repeat 215..230 CDD:275378 0/14 (0%)
Ig 278..391 CDD:299845 27/128 (21%)
I-set 279..391 CDD:254352 27/127 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.