DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and negr1

DIOPT Version :10

Sequence 1:NP_731670.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_031755650.1 Gene:negr1 / 100127726 XenbaseID:XB-GENE-987949 Length:388 Species:Xenopus tropicalis


Alignment Length:202 Identity:56/202 - (27%)
Similarity:89/202 - (44%) Gaps:48/202 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 NITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHII------SVDETTFIADERFQSIYQEDHDYT 472
            |:..:.|..|.:.|.:...:.|. :|:. |.:.|.      |||....||....|.         
 Frog    48 NLVVRQGETAMLRCFLEEGASKG-AWLN-RSSIIFAGGDKWSVDPRVSIATSSKQE--------- 101

  Fly   473 WSLQIKYVEPSDAGWYECQMATE--PKLSAKVHLQI-VKPKT-ELIGDQSRFVKAGSKVALHCIV 533
            :||:|:.|:.||.|.|.|.:.||  |: :.:|||.: |.||. ::..|.:  |..|:.|:|.|:.
 Frog   102 YSLRIQKVDVSDDGPYTCSVQTEHSPR-TLQVHLTVHVSPKIYDISSDMT--VNEGTNVSLICLA 163

  Fly   534 RGTLDPPKYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTC 598
            .|..:|.  |.|    :.||.|.::.|....||  |:|                :.::.:|:|.|
 Frog   164 TGKPEPS--ISW----RHISPSAKQFGSGQYLD--IYG----------------ITRDQAGDYEC 204

  Fly   599 QPSNSVS 605
            ...|.||
 Frog   205 SAENDVS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_731670.1 V-set 415..507 CDD:462230 28/100 (28%)
IG_like 521..612 CDD:214653 23/85 (27%)
Ig strand B 527..531 CDD:409353 2/3 (67%)
Ig strand C 542..546 CDD:409353 1/3 (33%)
Ig strand E 581..585 CDD:409353 0/3 (0%)
Ig strand F 595..600 CDD:409353 2/4 (50%)
negr1XP_031755650.1 Ig 44..136 CDD:472250 29/99 (29%)
Ig strand B 57..61 CDD:409353 1/3 (33%)
Ig strand C 70..73 CDD:409353 0/3 (0%)
Ig strand E 102..106 CDD:409353 2/3 (67%)
Ig strand F 116..121 CDD:409353 2/4 (50%)
Ig strand G 129..132 CDD:409353 0/2 (0%)
Ig 146..222 CDD:472250 24/92 (26%)
Ig strand B 157..161 CDD:409301 2/3 (67%)
Ig strand C 170..174 CDD:409301 2/9 (22%)
Ig strand E 187..191 CDD:409301 2/5 (40%)
Ig strand F 201..206 CDD:409301 2/4 (50%)
Ig strand G 215..218 CDD:409301
Ig_3 226..302 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.