DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14740 and AT2G11270

DIOPT Version :10

Sequence 1:NP_650152.1 Gene:CG14740 / 41468 FlyBaseID:FBgn0037988 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_001318210.1 Gene:AT2G11270 / 815597 AraportID:AT2G11270 Length:83 Species:Arabidopsis thaliana


Alignment Length:32 Identity:16/32 - (50%)
Similarity:23/32 - (71%) Gaps:2/32 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EREKFLGIKCLHGKKIIGQISVNSVIGGMRGL 75
            :|.|.|.:|  |||..:|.|:|:.|:|||||:
plant    44 DRSKKLKLK--HGKVPVGNITVDMVLGGMRGM 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14740NP_650152.1 ScCS-like 33..458 CDD:99857 16/32 (50%)
AT2G11270NP_001318210.1 CS_ACL-C_CCL 43..>76 CDD:469765 16/32 (50%)

Return to query results.
Submit another query.