DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14739 and UBC5

DIOPT Version :9

Sequence 1:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_564817.2 Gene:UBC5 / 842683 AraportID:AT1G63800 Length:185 Species:Arabidopsis thaliana


Alignment Length:179 Identity:73/179 - (40%)
Similarity:104/179 - (58%) Gaps:12/179 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RRLDRDVNRLLASGYRT-TVDDDMTNLNVCLEGPLGSAYEGGIWTVNVTMPQDYPLTAPRVRFVT 79
            :|.:.|:.:|:.|.|:. .::|.|....|...||..|.||||:|.:.|.:|..||..:|.|.|:|
plant     6 KRREMDLMKLMMSDYKVEMINDGMQEFFVEFSGPKDSIYEGGVWKIRVELPDAYPYKSPSVGFIT 70

  Fly    80 KILHPNIEFITGLVCMNVLKQAWSSSYDLVNIFETFLPQLLRYPNPHDSLNHRAAAIMKHSEQLF 144
            ||.|||::.::|.||::|:.|.||..:||||:|||||||||.||||.|.||..|||:|......:
plant    71 KIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPLNGEAAALMMRDRPTY 135

  Fly   145 REHVILCMKTYAMPANLPTRQLVEEGLEKRSSD--LSLSDLLTDSDDDD 191
            .:.|....:.||.|         ....|:.|||  :|..:..:|.||:|
plant   136 EQRVKEYCEKYAKP---------RADTEEMSSDDEMSEDEYASDGDDED 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14739NP_650151.1 COG5078 12..157 CDD:227410 62/141 (44%)
UQ_con 17..152 CDD:278603 61/135 (45%)
UBC5NP_564817.2 UQ_con 7..143 CDD:365926 61/135 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0416
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1301162at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.