DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14739 and ube2h

DIOPT Version :9

Sequence 1:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001004909.1 Gene:ube2h / 448270 XenbaseID:XB-GENE-941252 Length:183 Species:Xenopus tropicalis


Alignment Length:181 Identity:72/181 - (39%)
Similarity:109/181 - (60%) Gaps:8/181 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PMAG-RRLDRDVNRLLASGYRTTVDDDMTNLNVCLEGPLGSAYEGGIWTVNVTMPQDYPLTAPRV 75
            |..| ||:|.||.:|:.|.:..|:...:....|...||.|:.||||:|.|.|.:|..||..:|.:
 Frog     4 PSPGKRRMDTDVVKLIESKHEVTILGGLNEFIVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSI 68

  Fly    76 RFVTKILHPNIEFITGLVCMNVLKQAWSSSYDLVNIFETFLPQLLRYPNPHDSLNHRAAAIMKHS 140
            .|:.||.||||:..:|.||::|:.|.|::.|||.||||:||||||.||||.|.||..|||:..|.
 Frog    69 GFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHR 133

  Fly   141 EQLFREHVILCMKTYAMPANLPTRQLVEEGLEKRSSDLSLSDLLTDSDDDD 191
            .:.:::.:...::.||      |.:.::| .|:|:.|.|....::|..:|:
 Frog   134 PEEYKQKIKEYIQKYA------TEEALKE-QEERTGDSSSESSMSDFSEDE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14739NP_650151.1 COG5078 12..157 CDD:227410 63/145 (43%)
UQ_con 17..152 CDD:278603 59/134 (44%)
ube2hNP_001004909.1 UQ_con 31..145 CDD:395127 52/113 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1301162at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.