DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14739 and vih

DIOPT Version :9

Sequence 1:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster


Alignment Length:143 Identity:40/143 - (27%)
Similarity:74/143 - (51%) Gaps:13/143 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RRLDRD-VNRLLASGYRTTVDDDMTNLNV---CLEGPLGSAYEGGIWTVNVTMPQDYPLTAPRVR 76
            :||.:: :|.::|:....:...|..|:..   .:.||..:.|.|..:.:::..|..||..||.|:
  Fly    35 KRLHKELMNLMMANERGISAFPDGENIFKWVGTIAGPRNTVYSGQTYRLSLDFPNSYPYAAPVVK 99

  Fly    77 FVTKILHPNIEFITGLVCMNVLKQAWSSSYDLVNIFETFLPQLLRYPNPHDSLNHRAAAI----- 136
            |:|...|||:: :.|.:|:::||..||:.||:..|..: :..||..||....||.:||.:     
  Fly   100 FLTSCFHPNVD-LQGAICLDILKDKWSALYDVRTILLS-IQSLLGEPNNESPLNAQAAMMWNDQK 162

  Fly   137 --MKHSEQLFREH 147
              .|:.:..:.:|
  Fly   163 EYKKYLDAFYEKH 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14739NP_650151.1 COG5078 12..157 CDD:227410 40/143 (28%)
UQ_con 17..152 CDD:278603 40/142 (28%)
vihNP_648582.1 COG5078 31..166 CDD:227410 38/132 (29%)
UQ_con 36..172 CDD:278603 39/137 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438040
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.