DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14739 and UbcE2M

DIOPT Version :9

Sequence 1:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster


Alignment Length:140 Identity:42/140 - (30%)
Similarity:72/140 - (51%) Gaps:6/140 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RLDRDVNRL-LASGYRTTVDD--DMTNLNVCLEGPLGSAYEGGIWTVNVTMPQDYPLTAPRVRFV 78
            |:.:|:|.| |.:...|...|  |:.|..:.: .|....|..|.:..|..:..:||...|:|:..
  Fly    30 RIQKDINELNLPNTCATDFPDPNDLLNFKLII-SPDEGFYRDGRFVFNFRVGSNYPHEPPKVKCA 93

  Fly    79 TKILHPNIEFITGLVCMNVLKQAWSSSYDLVNIFETFLPQLLRYPNPHDSLNHRAAAIMKHSEQL 143
            |::.||||: :.|.||:|:|::.|:...: :|.....|..|...|||.|.||..||.:::.:.:.
  Fly    94 TQVYHPNID-LDGNVCLNILREDWNPVLN-INSIVYGLQFLFLEPNPEDPLNKEAADVLQTNRRQ 156

  Fly   144 FREHVILCMK 153
            |..:|...|:
  Fly   157 FENNVKKAMR 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14739NP_650151.1 COG5078 12..157 CDD:227410 42/140 (30%)
UQ_con 17..152 CDD:278603 41/137 (30%)
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 41/137 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438193
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.