DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14739 and CG17030

DIOPT Version :9

Sequence 1:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster


Alignment Length:179 Identity:36/179 - (20%)
Similarity:77/179 - (43%) Gaps:28/179 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RRLDRDVNRLLASGYRTTVDDDMTNL---NVCLEG-----------PLGSAYEGGIWTVNVTMPQ 66
            :|::|::..:|         :|..||   |:.:|.           |:...|:.|.:.:.:..|.
  Fly    13 KRMNRELALML---------EDKQNLQFRNLLVEPNNIYKWTGLLMPVAPPYDKGAYKMEIDFPL 68

  Fly    67 DYPLTAPRVRFVTKILHPNIEFITGLVCMNVLK-QAWSSSYDLVNIFETFLPQLLRYPNPHDSLN 130
            |||...||:...|::.|.|:. ..|.||:.:|: :.|..:..:..:.:..| ..:..|.|.::.:
  Fly    69 DYPFKPPRIHINTRMYHLNVN-ERGQVCVPILEVEHWIPTTRIDQVLQVLL-ATINDPQPENAWH 131

  Fly   131 HRAAAIMKHSEQLFREHVILCMKTYAMPANLPTRQLVEEGLEKRSSDLS 179
            ...|...::....|.:.....::.|:.|.  ||.:.:.:...||...::
  Fly   132 IEMAGEYRNDPVRFFKMADAWVQKYSEPR--PTEEELAKFARKRKKAMT 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14739NP_650151.1 COG5078 12..157 CDD:227410 31/155 (20%)
UQ_con 17..152 CDD:278603 30/149 (20%)
CG17030NP_647941.1 COG5078 12..158 CDD:227410 31/155 (20%)
UQ_con 14..153 CDD:278603 30/149 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.