DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14739 and CG10862

DIOPT Version :9

Sequence 1:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster


Alignment Length:149 Identity:42/149 - (28%)
Similarity:74/149 - (49%) Gaps:6/149 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PMAGRRLDRDVNRL---LASGYRT-TVDDDMTNLNVCLEGPLGSAYEGGIWTVNVTMPQDYPLTA 72
            |:...||.|:::..   ...|.:. .|.|::.:....:.||..:.||||.:.|.:..|::||...
  Fly   207 PLTITRLRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYP 271

  Fly    73 PRVRFVTKILHPNIEFITGLVCMNVLKQAWSSSYDLVNIFETFLPQLLRYPNPHDSLNHRAAAIM 137
            |.:.|:||..|.||. ::|.:|:::|...||.:..:..:..:.: .||..|||||.:....|.:.
  Fly   272 PYLAFLTKTYHCNIA-LSGRICLDILGSKWSPALSVSKVLISIM-SLLADPNPHDPMEVSVADVF 334

  Fly   138 KHSEQLFREHVILCMKTYA 156
            |.:..|..::.....|.||
  Fly   335 KGNRALHDKNAREWTKKYA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14739NP_650151.1 COG5078 12..157 CDD:227410 42/149 (28%)
UQ_con 17..152 CDD:278603 38/138 (28%)
CG10862NP_647823.1 COG5078 207..354 CDD:227410 42/149 (28%)
UQ_con 212..349 CDD:278603 38/138 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.