DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14739 and CG3473

DIOPT Version :9

Sequence 1:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster


Alignment Length:149 Identity:53/149 - (35%)
Similarity:84/149 - (56%) Gaps:14/149 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RLDRDVNRLL---ASGYRTTVDD-DMTNLNVCLEGPLGSAYEGGIWTVNVTMPQDYPLTAPRVRF 77
            |:.::..|||   ..|...|.|: :....:|.:.||..|.:|||.:.:.:.:|:|||:.||:|||
  Fly     7 RIIKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRF 71

  Fly    78 VTKILHPNIEFITGLVCMNVLKQAWSSSYDLVNIFETFLPQLLRYPNPHDSLNHRAAAIMKHSE- 141
            :|||.||||:.: |.:|:::||..||.:..:..:..: :..||..|||.|.|.:..|.:.|.:| 
  Fly    72 LTKIFHPNIDRV-GRICLDILKDKWSPALQIRTVLLS-IQALLSAPNPDDPLANDVAELWKVNER 134

  Fly   142 ---QLFREHVILCMKTYAM 157
               ||.||    |...:||
  Fly   135 RAIQLARE----CTLKHAM 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14739NP_650151.1 COG5078 12..157 CDD:227410 51/147 (35%)
UQ_con 17..152 CDD:278603 50/142 (35%)
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 53/149 (36%)
COG5078 7..149 CDD:227410 51/147 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438131
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.