DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14739 and Ubc2

DIOPT Version :9

Sequence 1:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster


Alignment Length:161 Identity:46/161 - (28%)
Similarity:70/161 - (43%) Gaps:19/161 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TLPMAGRRLDRDVNRLLASGYRTTVD-----------DDMTNLNVCLEGPLGSAYEGGIWTVNVT 63
            |.|...|.|.....|:.......|:|           |::......:.||.||.||||::.:::.
  Fly    76 TTPRISRALGTSAKRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIH 140

  Fly    64 MPQDYPLTAPRVRFVTKILHPNIEFITGLVCMNVLKQAWSSSYDLVNIFETFLPQLLRYPNPHDS 128
            ...:||...|:|.|.|:|.|.||. ..|::|:::||..||.:..:..:..: :..||...||.|.
  Fly   141 FSPEYPFKPPKVTFRTRIYHCNIN-SQGVICLDILKDNWSPALTISKVLLS-ICSLLTDCNPADP 203

  Fly   129 LNHRAAAIMKHSEQLFREH---VILCMKTYA 156
            |   ..:|.....|...||   ..|..|.||
  Fly   204 L---VGSIATQYLQNREEHDRIARLWTKRYA 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14739NP_650151.1 COG5078 12..157 CDD:227410 45/159 (28%)
UQ_con 17..152 CDD:278603 40/148 (27%)
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 40/149 (27%)
UQ_con 90..227 CDD:278603 39/141 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.