DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14739 and CG4502

DIOPT Version :9

Sequence 1:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster


Alignment Length:160 Identity:37/160 - (23%)
Similarity:67/160 - (41%) Gaps:38/160 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RDVNRLLASGYRT----TVDDDMTNLNVCL-----EGPLG-SAYEGGIWTV--NVTMPQDYPLTA 72
            |::.||.|.....    .|:|.:...:|.|     :.||. ...|.|:..:  :::.|.::|...
  Fly   148 REMERLQAKNDAVFTVELVNDSLFEWHVRLHVIDPDSPLARDMAEMGVPAILLHLSFPDNFPFAP 212

  Fly    73 PRVRFVTKILHPNIE--FIT--GLVCMNVL-KQAWSSSYDLVNIFETFLP-------QLLRYPNP 125
            |.:|    ::.|:||  ::.  |.:||.:| .:.|:|:|.:..:...|..       ::.|.|..
  Fly   213 PFMR----VVEPHIEKGYVMEGGAICMELLTPRGWASAYTVEAVIMQFAASVVKGQGRIARKPKS 273

  Fly   126 HDSLNHRAAAIMKHSEQLFREHVILCMKTY 155
            ......|.|      |:.||..|    ||:
  Fly   274 TKEFTRRQA------EESFRSLV----KTH 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14739NP_650151.1 COG5078 12..157 CDD:227410 37/160 (23%)
UQ_con 17..152 CDD:278603 35/155 (23%)
CG4502NP_609103.1 UBCc 140..>258 CDD:238117 27/113 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.