DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14739 and CG5440

DIOPT Version :10

Sequence 1:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_608594.2 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster


Alignment Length:125 Identity:38/125 - (30%)
Similarity:64/125 - (51%) Gaps:8/125 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NTTLPMAGRRLD---RDVNRLLASGYRTTVDDDMTNLNVCLEGPLGSAYEGGIWTVNVTMPQDYP 69
            |:.:....:.||   ||..:..::|.:   :|::......:.||..|.||.||:.:::..|.:||
  Fly    20 NSAVKRIQKELDEITRDPPQYCSAGPK---EDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYP 81

  Fly    70 LTAPRVRFVTKILHPNIEFITGLVCMNVLKQAWSSSYDLVNIFETFLPQLLRYPNPHDSL 129
            ...|.|.|.|.|.|.||..: |.:|:::||:.||.:..:..|..: :..||...||.|.|
  Fly    82 FAPPVVIFRTPIYHCNIHRL-GFICLDILKEKWSPALTISKILLS-ICSLLTDCNPKDPL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14739NP_650151.1 UBCc_UBE2H 16..152 CDD:467417 37/117 (32%)
CG5440NP_608594.2 UBCc_UBE2E 24..164 CDD:467413 37/121 (31%)

Return to query results.
Submit another query.