DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14739 and ben

DIOPT Version :9

Sequence 1:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster


Alignment Length:137 Identity:49/137 - (35%)
Similarity:82/137 - (59%) Gaps:9/137 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TTLPMAGRRLDRDVNRLL---ASGYRTTVDDDMTN-LNVCLEGPLGSAYEGGIWTVNVTMPQDYP 69
            ::||   ||:.::..||:   ..|.....|::... .:|.:.||..|.:|||::.:.:.:|:|||
  Fly     2 SSLP---RRIIKETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYP 63

  Fly    70 LTAPRVRFVTKILHPNIEFITGLVCMNVLKQAWSSSYDLVNIFETFLPQLLRYPNPHDSLNHRAA 134
            ::||:|||:|||.||||:.: |.:|::|||..||.:..:..|..: :..||..|||.|.|.:..|
  Fly    64 MSAPKVRFITKIYHPNIDRL-GRICLDVLKDKWSPALQIRTILLS-IQALLSAPNPDDPLANDVA 126

  Fly   135 AIMKHSE 141
            .:.|.:|
  Fly   127 ELWKVNE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14739NP_650151.1 COG5078 12..157 CDD:227410 48/134 (36%)
UQ_con 17..152 CDD:278603 46/129 (36%)
benNP_001162752.1 UBCc 3..149 CDD:412187 49/136 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438129
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.