DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14739 and CG2924

DIOPT Version :10

Sequence 1:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_569994.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster


Alignment Length:48 Identity:19/48 - (39%)
Similarity:26/48 - (54%) Gaps:1/48 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VNVTMPQDYPLTAPRVRFVTKILHPNIEFITGLVCMNVL-KQAWSSSY 106
            :|:...:.||...|.||.|..|:......|.|.:||.:| ||.|||:|
  Fly   288 LNILFKETYPFEPPFVRVVHPIISGGYVLIGGAICMELLTKQGWSSAY 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14739NP_650151.1 UBCc_UBE2H 16..152 CDD:467417 19/48 (40%)
CG2924NP_569994.1 UBCc_UBE2Q 225..384 CDD:467422 19/48 (40%)

Return to query results.
Submit another query.