DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14739 and ubc8

DIOPT Version :10

Sequence 1:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_596617.1 Gene:ubc8 / 2540738 PomBaseID:SPBC211.07C Length:184 Species:Schizosaccharomyces pombe


Alignment Length:195 Identity:76/195 - (38%)
Similarity:107/195 - (54%) Gaps:22/195 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RRLDRDVNRLLASGYRTT-VDDDMTNLNVCLEGPLGSAYEGGIWTVNVTMPQDYPLTAPRVRFVT 79
            ||::.||.:||.|.|..| |:|:|....|...||..:.|.||||.|:|.:|.:||..:|.:.||.
pombe     6 RRIETDVMKLLMSDYEVTLVNDNMQEFYVRFHGPSETPYSGGIWKVHVELPSEYPWKSPSIGFVN 70

  Fly    80 KILHPNIEFITGLVCMNVLKQAWSSSYDLVNIFETFLPQLLRYPNPHDSLNHRAAAIMKHSEQLF 144
            :|.||||:.::|.||::|:.|.||..:|::||||.||||||||||..|.||..|||::......:
pombe    71 RIFHPNIDELSGSVCLDVINQTWSPMFDMINIFEVFLPQLLRYPNASDPLNGEAAALLLREPNTY 135

  Fly   145 REHVILCMKTYAMPANLPTRQLVEEGLEKRSSDLSLSDLLTDSDDD---DVGNRNNAHIALPGSS 206
                      ||     ..|..:.....|..:|::|:|   .||||   .:...:...||.|..|
pombe   136 ----------YA-----KVRDYIARYANKEDADITLND---SSDDDTMSSIDTESGDEIAGPMDS 182

  Fly   207  206
            pombe   183  182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14739NP_650151.1 UBCc_UBE2H 16..152 CDD:467417 61/136 (45%)
ubc8NP_596617.1 UBCc_UBE2H 6..143 CDD:467417 64/151 (42%)

Return to query results.
Submit another query.