DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and PHB2

DIOPT Version :9

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_011747.2 Gene:PHB2 / 853146 SGDID:S000003463 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:209 Identity:46/209 - (22%)
Similarity:96/209 - (45%) Gaps:42/209 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GLVFILPCIDETHRVDMRTDVTNVRPQDVL----TKD----SVTITV----NAVVYYCIYSPIDS 157
            |..||.|.:|.....|:|     .:|::|.    |||    ::|..|    :.|....||..:. 
Yeast    84 GTHFIFPWLDTPIIYDVR-----AKPRNVASLTGTKDLQMVNITCRVLSRPDVVQLPTIYRTLG- 142

  Fly   158 IIQVDDAKQATQLISQVTLRNIVGSKTLNVLLTSRQQLSREIQQAVAGITYRWGVRVERVDVMDI 222
              |..|.:....::::| |:.:|.....:.|:|.|:::||.|::.:.....::.:.::.|.:..:
Yeast   143 --QDYDERVLPSIVNEV-LKAVVAQFNASQLITQREKVSRLIRENLVRRASKFNILLDDVSITYM 204

  Fly   223 TLPTSLERSLASEAEAV----------------REARAKIILAEGELKASKALKEASDVMSENKI 271
            |.  |.|.:.|.||:.:                :|.:..::.|:||.|:::.:.||   :.:::.
Yeast   205 TF--SPEFTNAVEAKQIAQQDAQRAAFVVDKARQEKQGMVVRAQGEAKSAELIGEA---IKKSRD 264

  Fly   272 TLQLRHLQILSSIA 285
            .::|:.|.....||
Yeast   265 YVELKRLDTARDIA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 30/131 (23%)
SPFH_like 100..305 CDD:302763 46/209 (22%)
PHB2NP_011747.2 SPFH_prohibitin 58..252 CDD:259799 40/178 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.