DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and stoml1

DIOPT Version :9

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001039193.1 Gene:stoml1 / 734047 XenbaseID:XB-GENE-990189 Length:361 Species:Xenopus tropicalis


Alignment Length:267 Identity:76/267 - (28%)
Similarity:127/267 - (47%) Gaps:26/267 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VIITFPFSMCCCLTIVPEYSRMIILRLGRLRKGLRGPGLVFILPCIDETHRVDMRTDVTNVRPQD 132
            :|:|||.|..|.|.:||:|.|::|.||||: :..||||||.:.|.||:..||||||...:|.|..
 Frog    48 LIVTFPLSAWCFLKMVPDYQRIVIFRLGRV-QAARGPGLVLLFPLIDQFQRVDMRTKAFSVPPSK 111

  Fly   133 VLTKDSVTITVNAVVYYCIYSPIDSIIQVDDAKQATQLISQVTLRNIVGSKTLNVLLTSRQQLSR 197
            |.::|.|.:::.|.:.:||..|:.|::.|.|....|:..:|..:...:|.|.|..:...|.:::.
 Frog   112 VKSRDGVLVSMGADIQFCICDPVLSVLSVQDLNFVTRNTAQNLMTQSLGRKYLREIQNDRARIAE 176

  Fly   198 EIQQAVAGITYRWGVRVERVDVMDITLPTSLERSLASEAEAVREARAKIILAEG-------ELKA 255
            .:::.:......||:.||||::       :||..|.:...|:........:..|       :..|
 Frog   177 HLKEDLNEQVKPWGLCVERVEL-------ALESILQTPENALIVPSVTPAVPCGGIDQLLMQFLA 234

  Fly   256 SKALKEASDVMSENKITLQLRHL----------QILSSIASERRVRIIYPIPLEIMEPFMSGKEG 310
            .......:|..|.....|.|:.|          .::|.:.|..::.:..| ..:|.|.|:..|.|
 Frog   235 LTRQSSGNDSPSLKDTDLSLKQLLSKVEASLTESLVSEVGSSYQLYVTMP-GGQISEYFLDLKSG 298

  Fly   311 QKKDGGG 317
            ....|.|
 Frog   299 SGNCGWG 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 50/146 (34%)
SPFH_like 100..305 CDD:302763 55/221 (25%)
stoml1NP_001039193.1 PHB 60..198 CDD:214581 49/138 (36%)
SPFH_SLP-1 75..205 CDD:259814 43/137 (31%)
SCP2 254..357 CDD:280250 12/53 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.