DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and stoml3a

DIOPT Version :9

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001092220.1 Gene:stoml3a / 571219 ZFINID:ZDB-GENE-070620-18 Length:284 Species:Danio rerio


Alignment Length:250 Identity:123/250 - (49%)
Similarity:177/250 - (70%) Gaps:8/250 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 WFLVIIT-------FPFSMCCCLTIVPEYSRMIILRLGR-LRKGLRGPGLVFILPCIDETHRVDM 121
            |.::||.       .|.::..|:.||.||.|.:|.|||| |.|..:|||:.|:|||.|...:||:
Zfish    32 WLIIIIAIIITIGLLPITIFMCIKIVQEYERAVIFRLGRILDKKPKGPGIFFVLPCTDSFMKVDL 96

  Fly   122 RTDVTNVRPQDVLTKDSVTITVNAVVYYCIYSPIDSIIQVDDAKQATQLISQVTLRNIVGSKTLN 186
            ||...|:..|:.|||||||:.|:.|||:.::.||.|:..|.:|.|||||::|.||||::|:|.|:
Zfish    97 RTVTFNIPAQEFLTKDSVTVNVDGVVYFRVFDPICSVANVSNANQATQLLAQTTLRNVLGTKNLS 161

  Fly   187 VLLTSRQQLSREIQQAVAGITYRWGVRVERVDVMDITLPTSLERSLASEAEAVREARAKIILAEG 251
            .||:.|:.:|..:|.|:...|..||::||||::.|:.||..|:|::|:||||.||||||:|.|||
Zfish   162 ELLSDREGISNSMQIALDEATGVWGIKVERVEIKDVKLPIQLQRAMAAEAEASREARAKVIAAEG 226

  Fly   252 ELKASKALKEASDVMSENKITLQLRHLQILSSIASERRVRIIYPIPLEIMEPFMS 306
            |:.||:||||||.|::|:...||||:||.||:||:||...||:|:|::|:..|.|
Zfish   227 EMNASRALKEASLVIAESPSALQLRYLQTLSTIAAERNSTIIFPLPIDIIHHFTS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 70/147 (48%)
SPFH_like 100..305 CDD:302763 104/204 (51%)
stoml3aNP_001092220.1 PHB 52..204 CDD:214581 72/151 (48%)
SPFH_like 77..274 CDD:302763 103/196 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.