DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and zgc:112408

DIOPT Version :9

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001017597.1 Gene:zgc:112408 / 550260 ZFINID:ZDB-GENE-050417-63 Length:291 Species:Danio rerio


Alignment Length:252 Identity:124/252 - (49%)
Similarity:185/252 - (73%) Gaps:8/252 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GICWF--------LVIITFPFSMCCCLTIVPEYSRMIILRLGRLRKGLRGPGLVFILPCIDETHR 118
            |.|.:        |:..|||.|:..|:.:|.||.|.:|.|||||..|.:||||.:|:||:|...:
Zfish    38 GFCGYILTFFSCLLIFFTFPVSVWFCMKVVQEYERAVIFRLGRLLGGAKGPGLFWIIPCMDTFRK 102

  Fly   119 VDMRTDVTNVRPQDVLTKDSVTITVNAVVYYCIYSPIDSIIQVDDAKQATQLISQVTLRNIVGSK 183
            ||:||...::..|:||||||||..|:|||||.|::|..||.:|::|..|||:|:|.||||::|:|
Zfish   103 VDLRTVSFDIPAQEVLTKDSVTTMVDAVVYYRIFNPTVSITKVENANYATQMIAQTTLRNMLGTK 167

  Fly   184 TLNVLLTSRQQLSREIQQAVAGITYRWGVRVERVDVMDITLPTSLERSLASEAEAVREARAKIIL 248
            :|..:|..|:::|.:::..:...:..||::||||::.|:.|||:|:|::|:||||.|:||||:|.
Zfish   168 SLADILKDREEMSEQMEAVLYSASKNWGIKVERVELKDVKLPTTLQRAMAAEAEASRDARAKVIA 232

  Fly   249 AEGELKASKALKEASDVMSENKITLQLRHLQILSSIASERRVRIIYPIPLEIMEPFM 305
            ||||:|||:|||||::||||:...||||::|.|:.|||||...||:|:|:::|..||
Zfish   233 AEGEMKASRALKEAANVMSESPAALQLRYMQTLTEIASERNSTIIFPVPMDLMSGFM 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 67/146 (46%)
SPFH_like 100..305 CDD:302763 104/204 (51%)
zgc:112408NP_001017597.1 HflC 44..290 CDD:223407 122/246 (50%)
SPFH_like 83..283 CDD:302763 103/199 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.