DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and phb2b

DIOPT Version :9

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001002681.2 Gene:phb2b / 436954 ZFINID:ZDB-GENE-040718-430 Length:303 Species:Danio rerio


Alignment Length:276 Identity:65/276 - (23%)
Similarity:118/276 - (42%) Gaps:43/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PSRYIQTSED---NKDSTFEKVAIGICWFLVIITFPFSMCCCLTIVPEYSRMIIL-RLGRLR-KG 100
            |||::|...|   ...|......||:...:......:.:......|....|.||. |:|.:: ..
Zfish     6 PSRFLQNLRDLMGRISSGSRGAGIGLKLLIGAGALAYGVREATYTVEGGQRAIIFNRIGGVQLDT 70

  Fly   101 LRGPGLVFILPCIDETHRVDMRTDVTNVRPQDV--LTKDSVTITVNAVVYYCIYSPIDSII---- 159
            :...||.|.:|........|:|     .||:.:  ||.......|| :....:..|:.|.:    
Zfish    71 VLTEGLHFRIPWFQYPIIYDIR-----ARPRKISSLTGSKDLQMVN-IALRVLSRPLASNLPIMY 129

  Fly   160 ----QVDDAKQATQLISQVTLRNIVGSKTLNVLLTSRQQLSREIQQAVAGITYRWGVRVERVDVM 220
                |..|.:....::::| |:::|.....:.|:|.|.|:|..|::.:......:.:.::.|.:.
Zfish   130 QQLGQDYDERVLPSIVNEV-LKSVVAKFNASQLITQRAQVSLLIRRELFERAKDFNIILDDVAIT 193

  Fly   221 DITLPTSLERSLASEAEAV----------------REARAKIILAEGELKASKALKEASDVMSEN 269
            :::.  |.|.:.|.||:.|                :|.:.|||.||||.:|:|.|.||   :::|
Zfish   194 ELSF--SREYTAAVEAKQVAQQEAQRAQFFVEKAKQEQKQKIIQAEGEAQAAKMLGEA---VTKN 253

  Fly   270 KITLQLRHLQILSSIA 285
            ...|:||.::...:||
Zfish   254 PGYLKLRRIRAAQNIA 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 32/158 (20%)
SPFH_like 100..305 CDD:302763 51/212 (24%)
phb2bNP_001002681.2 SPFH_prohibitin 49..243 CDD:259799 46/202 (23%)
PHB 49..209 CDD:214581 37/168 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.