DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and CG14644

DIOPT Version :9

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster


Alignment Length:266 Identity:118/266 - (44%)
Similarity:183/266 - (68%) Gaps:1/266 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PSRYIQTSEDNKDSTFEKVAIGICWFLVIITFPFSMCCCLTIVPEYSRMIILRLGRLR-KGLRGP 104
            |.|.::|||:...:..||....:...|:::..|:|:.|||.::.||.|.:|||||||| |..|||
  Fly    27 PQRNVKTSENVPPTCAEKTLFVLSMILIVLCLPWSLFCCLRVMSEYERAVILRLGRLRPKPPRGP 91

  Fly   105 GLVFILPCIDETHRVDMRTDVTNVRPQDVLTKDSVTITVNAVVYYCIYSPIDSIIQVDDAKQATQ 169
            |::|::||||:...||:||...::..|::||:|.|||:::.||||.|.||.|:::||.|.::||:
  Fly    92 GVIFLVPCIDDLAVVDIRTRSFDLHRQEILTRDMVTISIDGVVYYSIKSPFDAMLQVYDPEEATE 156

  Fly   170 LISQVTLRNIVGSKTLNVLLTSRQQLSREIQQAVAGITYRWGVRVERVDVMDITLPTSLERSLAS 234
            .::..||||:.|:..|..||:|::.||.:|:..:...|..||:|||||::.:|.:|..|:|:||.
  Fly   157 KLAMTTLRNVAGTHKLMDLLSSKEYLSNQIEGILYNSTEPWGIRVERVEIKEIFMPDQLKRALAV 221

  Fly   235 EAEAVREARAKIILAEGELKASKALKEASDVMSENKITLQLRHLQILSSIASERRVRIIYPIPLE 299
            |.||:|||:||:..|:||..|..|||||:|:|..|.|.||||:||.|:||.::.....::|.|::
  Fly   222 EQEAMREAKAKVAAAQGERDAVTALKEAADIMETNPIALQLRYLQTLNSICNDDTRSYVFPFPVD 286

  Fly   300 IMEPFM 305
            |:...|
  Fly   287 IVRNLM 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 69/147 (47%)
SPFH_like 100..305 CDD:302763 92/204 (45%)
CG14644NP_649445.3 PHB 64..223 CDD:214581 74/158 (47%)
SPFH_like 89..292 CDD:302763 92/202 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473028
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10264
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6471
65.850

Return to query results.
Submit another query.