DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and stoml3

DIOPT Version :9

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_989344.1 Gene:stoml3 / 394970 XenbaseID:XB-GENE-1015871 Length:283 Species:Xenopus tropicalis


Alignment Length:301 Identity:127/301 - (42%)
Similarity:194/301 - (64%) Gaps:33/301 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SKHDQKIPPKEFKRPSADGGPRPPPSRYIQTSEDNKDSTFEKVAIGIC-W-------FLVIITFP 73
            |:..||...:|....:|||.                        ||:| |       |:..||||
 Frog     7 SQFSQKRQSREELIEAADGN------------------------IGVCGWIILILSAFMAAITFP 47

  Fly    74 FSMCCCLTIVPEYSRMIILRLGRLRKG-LRGPGLVFILPCIDETHRVDMRTDVTNVRPQDVLTKD 137
            .|:..|:.|:.||.|.::.||||:..| .:|||::|:|||.|...:||:|.....:.||::||||
 Frog    48 LSIWFCVKIIQEYERAVVFRLGRIISGKAKGPGVMFVLPCTDTFIKVDLRVISFAIPPQEILTKD 112

  Fly   138 SVTITVNAVVYYCIYSPIDSIIQVDDAKQATQLISQVTLRNIVGSKTLNVLLTSRQQLSREIQQA 202
            |||.||:.||||.|.|.|.::..|::...|||.::|.|||||:|::||..:|.:|::::..||..
 Frog   113 SVTTTVDGVVYYNIQSAIKAVANVNNVHIATQQLAQTTLRNILGTQTLANILANREEIAHNIQSI 177

  Fly   203 VAGITYRWGVRVERVDVMDITLPTSLERSLASEAEAVREARAKIILAEGELKASKALKEASDVMS 267
            :...|::|||:|:||::.|:.||..::|::|:||||.||||||::.||||:.||:||||||.|::
 Frog   178 LDHATHKWGVKVDRVEMRDVRLPVQMQRAMAAEAEAAREARAKVVAAEGEMNASRALKEASLVIA 242

  Fly   268 ENKITLQLRHLQILSSIASERRVRIIYPIPLEIMEPFMSGK 308
            |:...||||:||.|::||:|....|::|:|:|:|:.|:|.|
 Frog   243 ESPAALQLRYLQTLNTIAAENNSTIVFPLPIELMQGFLSRK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 64/147 (44%)
SPFH_like 100..305 CDD:302763 98/205 (48%)
stoml3NP_989344.1 SPFH_like 73..274 CDD:418525 96/200 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.