DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and stoml2

DIOPT Version :9

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_957325.1 Gene:stoml2 / 394006 ZFINID:ZDB-GENE-040426-1139 Length:355 Species:Danio rerio


Alignment Length:318 Identity:73/318 - (22%)
Similarity:140/318 - (44%) Gaps:64/318 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 VPEYSRMIILRLGRLRKGLRGPGLVFILPCIDETHRV-DMRTDVTNVRPQDVLTKDSVTITVNAV 146
            ||:....::.|:||..:.|. |||.|::|.:|....| .::..|.:|..|..::.|:||:.::.|
Zfish    46 VPQQEAWVVERMGRFHRILE-PGLNFLIPILDRIRYVQSLKEIVIDVPEQSAVSLDNVTLQIDGV 109

  Fly   147 VYYCIYSPIDSIIQVDDAKQATQLISQVTLRNIVGSKTLNVLLTSRQQLSREIQQAVAGITYRWG 211
            :|..|..|..:...|:|.:.|...::|.|:|:.:|..||:.:...|:.|:..|..::...:..||
Zfish   110 LYLRILDPFKASYGVEDPEYAVTQLAQTTMRSELGKLTLDKVFRERESLNSNIVHSINQASDEWG 174

  Fly   212 VRVERVDVMDITLPTSLERSLASEAEAVREARAKII-----------LAEGELKA---------- 255
            :|..|.::.||.:|..::.|:..:.||.|..||.::           :|||..:|          
Zfish   175 IRCLRYEIKDIHVPPRVKESMQMQVEAERRKRATVLESGGTRESAINVAEGRKQAQILASEGEKA 239

  Fly   256 ---SKALKEASDVMSENKITLQLRHLQILSSIASERRVRIIYPIPLEIMEPFMSGKEGQKKDGGG 317
               :||..||:.|::  |...:.:.:::||...:::                           .|
Zfish   240 EQINKAAGEANAVLA--KAEAKAKAIRLLSEALTQQ---------------------------NG 275

  Fly   318 GGGGGKETKKEDVAGGSKETRKEGGGSDSFSGGSSGGLLSKFI-----FAGKEEKNQT 370
            .........::.|:..||..::    |::....|:.|.:|..:     ..|...||||
Zfish   276 NAAASLSVAEQYVSAFSKLAKE----SNTILLPSNTGDISSMVTQAMTIYGSLSKNQT 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 41/142 (29%)
SPFH_like 100..305 CDD:302763 55/229 (24%)
stoml2NP_957325.1 PHB 45..199 CDD:214581 43/153 (28%)
SPFH_paraslipin 79..189 CDD:259811 29/109 (27%)
Band_7_C 264..326 CDD:292817 11/92 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.