DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and Stoml2

DIOPT Version :9

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster


Alignment Length:363 Identity:85/363 - (23%)
Similarity:162/363 - (44%) Gaps:60/363 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PFSMCCCLTIVPEYSRMIILRLGRLRKGLRGPGLVFILPCIDETHRVDMRTDVT-NVRPQDVLTK 136
            |.:|  |:..||:....::.|:||..: :..|||..::|..|:...|....::. :|..|..:|.
  Fly    38 PINM--CVMFVPQQEAWVVERMGRFHR-ILDPGLNILVPVADKIKYVQSLKEIAIDVPKQSAITS 99

  Fly   137 DSVTITVNAVVYYCIYSPIDSIIQVDDAKQATQLISQVTLRNIVGSKTLNVLLTSRQQLSREIQQ 201
            |:||::::.|:|..|..|..:...|:|.:.|...::|.|:|:.:|..:::.:...|:.|:..|..
  Fly   100 DNVTLSIDGVLYLRIIDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIVD 164

  Fly   202 AVAGITYRWGVRVERVDVMDITLPTSLERSLASEAEAVREARAKIILAEGELKASKALKEASDVM 266
            ::...:..||:...|.::.||.|||.:..::..:.||.|..||.|:.:||       ::||...:
  Fly   165 SINKASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEG-------VREAEINI 222

  Fly   267 SENKITLQLRHLQILSSIA-------------------SERRVRIIYPIPLEIMEPFMSGKEGQK 312
            :|.|     |..:||:|.|                   ::.|.|.:..|...     :|..:|| 
  Fly   223 AEGK-----RKSRILASEAERQEHINKASGEAAAIIAVADARARSLLAIAKS-----LSHLDGQ- 276

  Fly   313 KDGGGGGGGGKETKKEDVAGGSKETRKEGGGSDSFSGGSSGGLLSKFIFAGKEEKNQTTRAGDKS 377
                   .....|..|...|..|:..|.   :::....|:.|.::.|:       .|.....:..
  Fly   277 -------NAASLTLAEQYIGAFKKLAKT---NNTMILPSNPGDVNGFV-------AQALAVYNHV 324

  Fly   378 SDINEPCSSKSFIKGTGEALALNQETDEGLEVRKDEEN 415
            |:.|:...|...:||.|  ..||.::.|..|:::|:.:
  Fly   325 SNSNQATKSSENVKGVG--ACLNAKSVEYKELQEDKSS 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 37/147 (25%)
SPFH_like 100..305 CDD:302763 54/224 (24%)
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 41/160 (26%)
SPFH_paraslipin 80..188 CDD:259811 26/107 (24%)
Band_7_C 266..326 CDD:292817 13/82 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473041
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.