DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and Stoml1

DIOPT Version :9

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001292167.1 Gene:Stoml1 / 300748 RGDID:1559463 Length:398 Species:Rattus norvegicus


Alignment Length:279 Identity:80/279 - (28%)
Similarity:126/279 - (45%) Gaps:59/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 WFLVIITFPFSMCCCLTIVPEYSRMIILRLGRLRKGLRGPGLVFILPCIDETHRVDMRTDVTNVR 129
            :.|:::|||.|....|.|||.|.|||:.||||:|.. :|||:|.:||.||...|||:||...||.
  Rat    64 FLLLLLTFPISGWFALKIVPTYERMIVFRLGRIRNP-QGPGMVLLLPFIDSFQRVDLRTRAFNVP 127

  Fly   130 PQDVLTKDSVTITVNAVVYYCIYSPIDSIIQVDDAKQATQLISQVTLRNIVGSKTLNVLLTSRQQ 194
            |..:.:||...::|.|.|.:.|:.|:.|::.|.|...||::.:...:...:..:.|..:...:.:
  Rat   128 PCKLASKDGAVLSVGADVQFRIWDPVLSVMAVKDLNAATRMTAHNAMTKALLRRPLQEIQMEKLK 192

  Fly   195 LSREIQQAVAGITYRWGVRVERVDVMDITLPTSLERSLASEAEAVREARAKIILAEGELKASKAL 259
            :..::...:..:|..||:.|:||:             ||.||                     .|
  Rat   193 IGDQLLLEINDVTRAWGLEVDRVE-------------LAVEA---------------------VL 223

  Fly   260 KEASDVMSENKI--TLQLRHLQIL-SSIASERRVRIIYPIP----LEI---MEPFMSGKEGQKKD 314
            :...|.::...:  |||...|..| .|:.|..||    |.|    ||:   :||          .
  Rat   224 QPPQDSLAVPSLDSTLQQLALHFLGGSMTSVGRV----PSPGSDTLEMINEVEP----------P 274

  Fly   315 GGGGGGGGKETKKEDVAGG 333
            ....|.|.:.:.|:.||.|
  Rat   275 ASRAGAGTEPSPKQPVAEG 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 48/146 (33%)
SPFH_like 100..305 CDD:302763 56/214 (26%)
Stoml1NP_001292167.1 PHB 77..217 CDD:214581 48/153 (31%)
SPFH_SLP-1 94..224 CDD:259814 42/164 (26%)
SCP2 304..395 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.