DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and Stoml2

DIOPT Version :9

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001026816.1 Gene:Stoml2 / 298203 RGDID:1308285 Length:353 Species:Rattus norvegicus


Alignment Length:209 Identity:59/209 - (28%)
Similarity:109/209 - (52%) Gaps:14/209 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LTIVPEYSRMIILRLGRLRKGLRGPGLVFILPCIDETHRV-DMRTDVTNVRPQDVLTKDSVTITV 143
            :..||:....::.|:||..:.|. |||..::|.:|....| .::..|.||..|..:|.|:||:.:
  Rat    38 ILFVPQQEAWVVERMGRFHRILE-PGLNVLIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQI 101

  Fly   144 NAVVYYCIYSPIDSIIQVDDAKQATQLISQVTLRNIVGSKTLNVLLTSRQQLSREIQQAVAGITY 208
            :.|:|..|..|..:...|:|.:.|...::|.|:|:.:|..:|:.:...|:.|:..|..|:.....
  Rat   102 DGVLYLRIMDPYKASYGVEDPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNANIVDAINQAAD 166

  Fly   209 RWGVRVERVDVMDITLPTSLERSLASEAEAVREARAKIILAEGELKASKALKEASDVMSENKITL 273
            .||:|..|.::.||.:|..::.|:..:.||.|..||.::.:||       .:|::..::|.|   
  Rat   167 CWGIRCLRYEIKDIHVPPRVKESMQMQVEAERRKRATVLESEG-------TRESAINVAEGK--- 221

  Fly   274 QLRHLQILSSIASE 287
              :..|||:|.|.:
  Rat   222 --KQAQILASEAEK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 42/145 (29%)
SPFH_like 100..305 CDD:302763 54/189 (29%)
Stoml2NP_001026816.1 HflC 38..314 CDD:223407 59/209 (28%)
SPFH_paraslipin 74..184 CDD:259811 31/109 (28%)
Band_7_C 259..321 CDD:292817
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.