DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and Stom

DIOPT Version :9

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001011965.1 Gene:Stom / 296655 RGDID:1305109 Length:284 Species:Rattus norvegicus


Alignment Length:276 Identity:127/276 - (46%)
Similarity:194/276 - (70%) Gaps:14/276 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SRYIQTS---EDNKDSTFEKVAIGIC-WFL-------VIITFPFSMCCCLTIVPEYSRMIILRLG 95
            |.::|:.   |..:|::  |..:|.| |.|       |:||||.|:..|:.||.||.|:||.|||
  Rat     7 SGHVQSQRVPESFRDNS--KAELGPCGWILVAVSFIFVLITFPISIWICIKIVKEYERVIIFRLG 69

  Fly    96 R-LRKGLRGPGLVFILPCIDETHRVDMRTDVTNVRPQDVLTKDSVTITVNAVVYYCIYSPIDSII 159
            | |:.|.:||||.|||||.|...:|||||...::.||:|||||||||:|:.||||.:.:...::.
  Rat    70 RILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEVLTKDSVTISVDGVVYYRVQNATLAVA 134

  Fly   160 QVDDAKQATQLISQVTLRNIVGSKTLNVLLTSRQQLSREIQQAVAGITYRWGVRVERVDVMDITL 224
            .:.:|..||:|::|.||||.:|:|.|:.:|:.|::::..:|..:...|..||::||||::.|:.|
  Rat   135 NITNADSATRLLAQTTLRNALGTKNLSQILSDREEIAHHMQSTLDDATDDWGIKVERVEIKDVKL 199

  Fly   225 PTSLERSLASEAEAVREARAKIILAEGELKASKALKEASDVMSENKITLQLRHLQILSSIASERR 289
            |..|:|::|:||||.||||||:|.||||:.||:||||||.|::|:...||||:||.|::||:|:.
  Rat   200 PVQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASMVITESPAALQLRYLQTLTTIAAEKN 264

  Fly   290 VRIIYPIPLEIMEPFM 305
            ..|::|:|:::::..|
  Rat   265 STIVFPLPIDMLQGIM 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 68/147 (46%)
SPFH_like 100..305 CDD:302763 98/204 (48%)
StomNP_001011965.1 PHB 53..204 CDD:214581 70/150 (47%)
SPFH_stomatin 73..274 CDD:259801 98/200 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.