DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and Phb

DIOPT Version :9

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_114039.1 Gene:Phb / 25344 RGDID:3322 Length:272 Species:Rattus norvegicus


Alignment Length:215 Identity:50/215 - (23%)
Similarity:99/215 - (46%) Gaps:24/215 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 GPGLVFILPCIDETHRVDMRTDVTNVRPQDVLTKD--SVTITVNAVVYYCIYSPIDSI---IQVD 162
            |.|..|::|.:.:....|.|:...|| |....:||  :|.||:. :::..:.|.:..|   |..|
  Rat    51 GEGTHFLIPWVQKPIIFDCRSRPRNV-PVITGSKDLQNVNITLR-ILFRPVASQLPRIYTSIGED 113

  Fly   163 DAKQATQLISQVTLRNIVGSKTLNVLLTSRQQLSREIQQAVAGITYRWGVRVERVDVMDITLPTS 227
            ..::....|:...|:::|.......|:|.|:.:||::...:......:|:.::.|.:..:|....
  Rat   114 YDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKE 178

  Fly   228 LERSLASEAEAVREA--------------RAKIILAEGELKASKALKEASDVMSENKITLQLRHL 278
            ...::.::..|.:||              :|.||.|||:.||::.:  |:.:.:.....::||.|
  Rat   179 FTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELI--ANSLATAGDGLIELRKL 241

  Fly   279 QILSSIASE-RRVRIIYPIP 297
            :....||.: .|.|.|..:|
  Rat   242 EAAEDIAYQLSRSRNITYLP 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 29/126 (23%)
SPFH_like 100..305 CDD:302763 50/215 (23%)
PhbNP_114039.1 SPFH_prohibitin 27..221 CDD:259799 39/171 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.