DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and STOM

DIOPT Version :9

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_004090.4 Gene:STOM / 2040 HGNCID:3383 Length:288 Species:Homo sapiens


Alignment Length:289 Identity:127/289 - (43%)
Similarity:195/289 - (67%) Gaps:18/289 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KRPSADGGPRPPPSRYIQTSEDNKDSTFEKVAIGIC-WFLV-------IITFPFSMCCCLTIVPE 85
            ||.:.|...:..|..:       |||..:  .:|.| |.||       :||||.|:..|:.|:.|
Human     4 KRHTRDSEAQRLPDSF-------KDSPSK--GLGPCGWILVAFSFLFTVITFPISIWMCIKIIKE 59

  Fly    86 YSRMIILRLGR-LRKGLRGPGLVFILPCIDETHRVDMRTDVTNVRPQDVLTKDSVTITVNAVVYY 149
            |.|.||.|||| |:.|.:||||.|||||.|...:|||||...::.||::||||||||:|:.||||
Human    60 YERAIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYY 124

  Fly   150 CIYSPIDSIIQVDDAKQATQLISQVTLRNIVGSKTLNVLLTSRQQLSREIQQAVAGITYRWGVRV 214
            .:.:...::..:.:|..||:|::|.||||::|:|.|:.:|:.|::::..:|..:...|..||::|
Human   125 RVQNATLAVANITNADSATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDDATDAWGIKV 189

  Fly   215 ERVDVMDITLPTSLERSLASEAEAVREARAKIILAEGELKASKALKEASDVMSENKITLQLRHLQ 279
            |||::.|:.||..|:|::|:||||.||||||:|.||||:.||:||||||.|::|:...||||:||
Human   190 ERVEIKDVKLPVQLQRAMAAEAEASREARAKVIAAEGEMNASRALKEASMVITESPAALQLRYLQ 254

  Fly   280 ILSSIASERRVRIIYPIPLEIMEPFMSGK 308
            .|::||:|:...|::|:|:::::..:..|
Human   255 TLTTIAAEKNSTIVFPLPIDMLQGIIGAK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 66/147 (45%)
SPFH_like 100..305 CDD:302763 97/204 (48%)
STOMNP_004090.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 5/24 (21%)
SPFH_stomatin 73..274 CDD:259801 97/200 (49%)
Required for homooligomerization 265..273 2/7 (29%)
Required for lipid raft association 267..269 1/1 (100%)
Interaction with LANCL1. /evidence=ECO:0000269|PubMed:9512664 273..287 1/11 (9%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.