DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and sto-6

DIOPT Version :9

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_509943.1 Gene:sto-6 / 190619 WormBaseID:WBGene00006068 Length:298 Species:Caenorhabditis elegans


Alignment Length:304 Identity:129/304 - (42%)
Similarity:194/304 - (63%) Gaps:22/304 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IPPKEFKRPSADGGPRPPPSRYIQTSEDNKDSTFEKVAIGIC-WFLVI-------ITFPFSMCCC 79
            :|.:...|.:..|...|   |:::.|        :||....| |.|.|       :|.|.|:..|
 Worm     1 MPNQPQPRKATRGRAAP---RFMEMS--------DKVDFTACGWILTIFSYILAVLTLPISVFLC 54

  Fly    80 LTIVPEYSRMIILRLGRLRK-GLRGPGLVFILPCIDETHRVDMRTDVTNVRPQDVLTKDSVTITV 143
            :.:..||.|.:|.||||::. |.|||||.|::||||...::|:||....|.||::|:||:||:.|
 Worm    55 VKVAQEYERAVIFRLGRVKPGGARGPGLFFVVPCIDSYKKIDLRTLSFEVPPQELLSKDAVTVAV 119

  Fly   144 NAVVYYCIYSPIDSIIQVDDAKQATQLISQVTLRNIVGSKTLNVLLTSRQQLSREIQQAVAGITY 208
            :|||::.|.:...|:|.::||.::|:|::|.|||||:|:|||..:|:.|..:|.::|..:...|.
 Worm   120 DAVVFFRISNATISVINIEDAARSTKLLAQTTLRNILGTKTLTEMLSDRDVISLQMQATLDETTI 184

  Fly   209 RWGVRVERVDVMDITLPTSLERSLASEAEAVREARAKIILAEGELKASKALKEASDVMSENKITL 273
            .|||:||||::.|:.||..|:|.:|:||||.|:|.||||.||||..||.||.||:||:|.:...:
 Worm   185 PWGVKVERVEMKDVRLPYQLQRVMAAEAEATRDAMAKIIAAEGEKNASTALAEAADVISMSPCAI 249

  Fly   274 QLRHLQILSSIASERRVRIIYPIPLEIMEPFM--SGKEGQKKDG 315
            |||:||.|:||:||:...|::|.|:|:|..|:  .||...||.|
 Worm   250 QLRYLQTLNSISSEKNNTIVFPFPMEMMSRFIKRQGKHVLKKMG 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 65/147 (44%)
SPFH_like 100..305 CDD:302763 99/204 (49%)
sto-6NP_509943.1 PRK11029 37..>98 CDD:182913 25/60 (42%)
SPFH_like 74..275 CDD:388510 97/200 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.