DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and sto-5

DIOPT Version :10

Sequence 1:NP_731666.2 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001379952.1 Gene:sto-5 / 181730 WormBaseID:WBGene00006067 Length:381 Species:Caenorhabditis elegans


Alignment Length:115 Identity:28/115 - (24%)
Similarity:44/115 - (38%) Gaps:27/115 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 LDFVTAKPDRSEVAAPV---EVAKVDESTAVTSEN--------RKKNKKDKKKSESE-KAVE--- 507
            :|.:...||  ||...:   ...||..||::.|:.        .|.....|:.|||| |.::   
 Worm     1 MDRIIGLPD--EVLVKILSFVPTKVAVSTSILSKRWEFLWMWLTKLKFGSKRYSESEFKRLQCFL 63

  Fly   508 ---EPVQAAPT--SKKPTADDSMDFLDFVTAKEERVEEVAPVQEQVKEQK 552
               .|:..||.  |.:....||     ....::.|:..|..|...::|.|
 Worm    64 DRNLPLHRAPVIESFRLVLSDS-----HFKPEDIRMWVVVAVSRYIRELK 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14736NP_731666.2 SPFH_like 100..305 CDD:473137
sto-5NP_001379952.1 SPFH_like 167..368 CDD:473137
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.