DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and STOML3

DIOPT Version :9

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_660329.1 Gene:STOML3 / 161003 HGNCID:19420 Length:291 Species:Homo sapiens


Alignment Length:251 Identity:121/251 - (48%)
Similarity:181/251 - (72%) Gaps:9/251 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IGIC-W-------FLVIITFPFSMCCCLTIVPEYSRMIILRLGRLRKG-LRGPGLVFILPCIDET 116
            :|:| |       .|||||||.|:..||.|:.||.|.::.||||::.. .:||||:.:|||||..
Human    24 LGVCGWILFSLSFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPCIDVF 88

  Fly   117 HRVDMRTDVTNVRPQDVLTKDSVTITVNAVVYYCIYSPIDSIIQVDDAKQATQLISQVTLRNIVG 181
            .:||:||...|:.||::||:||||..|:.||||.|||.:.::..|:|..|||.|::|.||||::|
Human    89 VKVDLRTVTCNIPPQEILTRDSVTTQVDGVVYYRIYSAVSAVANVNDVHQATFLLAQTTLRNVLG 153

  Fly   182 SKTLNVLLTSRQQLSREIQQAVAGITYRWGVRVERVDVMDITLPTSLERSLASEAEAVREARAKI 246
            ::||:.:|..|::::..||..:...|..||:||.||::.|:.:|..|:||:|:||||.||||||:
Human   154 TQTLSQILAGREEIAHSIQTLLDDATELWGIRVARVEIKDVRIPVQLQRSMAAEAEATREARAKV 218

  Fly   247 ILAEGELKASKALKEASDVMSENKITLQLRHLQILSSIASERRVRIIYPIPLEIME 302
            :.||||:.|||:||.||.|::|:.|.||||:||.||::|:|:...|::|:|:.|:|
Human   219 LAAEGEMNASKSLKSASMVLAESPIALQLRYLQTLSTVATEKNSTIVFPLPMNILE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 66/147 (45%)
SPFH_like 100..305 CDD:302763 100/204 (49%)
STOML3NP_660329.1 SPFH_like 73..271 CDD:327503 98/197 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.