DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and Phb2

DIOPT Version :9

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001013053.1 Gene:Phb2 / 114766 RGDID:620203 Length:299 Species:Rattus norvegicus


Alignment Length:268 Identity:56/268 - (20%)
Similarity:106/268 - (39%) Gaps:78/268 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 GRLRKGLRGPG--LVFILPC-------------IDETHRVDMRTDVTNVRPQDVLTKDSVTITVN 144
            |||..|.||.|  |..:|..             ::..||......:..|: ||.:..:.:...:.
  Rat    10 GRLPSGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQ-QDTILAEGLHFRIP 73

  Fly   145 AVVYYCIY----------SPIDS-----------IIQVDDAKQATQLISQV-------------- 174
            ...|..||          ||..|           ::...:|::...:..::              
  Rat    74 WFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVN 138

  Fly   175 -TLRNIVGSKTLNVLLTSRQQLSREIQQAVAGITYRWGVRVERVDVMDITLPTSLERSLASEAEA 238
             .|:::|.....:.|:|.|.|:|..|::.:......:.:.::.|.:.:::.  |.|.:.|.||:.
  Rat   139 EVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSF--SREYTAAVEAKQ 201

  Fly   239 V----------------REARAKIILAEGELKASKALKEASDVMSENKITLQLRHLQILSSIA-- 285
            |                :|.|.||:.||||.:|:|.|.||   :|:|...::||.::...:|:  
  Rat   202 VAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEA---LSKNPGYIKLRKIRAAQNISKT 263

  Fly   286 ---SERRV 290
               |:.|:
  Rat   264 IATSQNRI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 30/180 (17%)
SPFH_like 100..305 CDD:302763 53/263 (20%)
Phb2NP_001013053.1 Necessary for transcriptional repression. /evidence=ECO:0000250|UniProtKB:Q99623 19..49 4/29 (14%)
PHB 39..201 CDD:214581 26/164 (16%)
SPFH_prohibitin 40..235 CDD:259799 35/197 (18%)
Necessary for transcriptional repression. /evidence=ECO:0000250|UniProtKB:Q99623 150..174 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.