Sequence 1: | NP_001287293.1 | Gene: | CG14736 / 41466 | FlyBaseID: | FBgn0037986 | Length: | 473 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001013053.1 | Gene: | Phb2 / 114766 | RGDID: | 620203 | Length: | 299 | Species: | Rattus norvegicus |
Alignment Length: | 268 | Identity: | 56/268 - (20%) |
---|---|---|---|
Similarity: | 106/268 - (39%) | Gaps: | 78/268 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 95 GRLRKGLRGPG--LVFILPC-------------IDETHRVDMRTDVTNVRPQDVLTKDSVTITVN 144
Fly 145 AVVYYCIY----------SPIDS-----------IIQVDDAKQATQLISQV-------------- 174
Fly 175 -TLRNIVGSKTLNVLLTSRQQLSREIQQAVAGITYRWGVRVERVDVMDITLPTSLERSLASEAEA 238
Fly 239 V----------------REARAKIILAEGELKASKALKEASDVMSENKITLQLRHLQILSSIA-- 285
Fly 286 ---SERRV 290 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14736 | NP_001287293.1 | PHB | 78..225 | CDD:214581 | 30/180 (17%) |
SPFH_like | 100..305 | CDD:302763 | 53/263 (20%) | ||
Phb2 | NP_001013053.1 | Necessary for transcriptional repression. /evidence=ECO:0000250|UniProtKB:Q99623 | 19..49 | 4/29 (14%) | |
PHB | 39..201 | CDD:214581 | 26/164 (16%) | ||
SPFH_prohibitin | 40..235 | CDD:259799 | 35/197 (18%) | ||
Necessary for transcriptional repression. /evidence=ECO:0000250|UniProtKB:Q99623 | 150..174 | 6/23 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0330 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |