DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and nphs2

DIOPT Version :9

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_017949096.1 Gene:nphs2 / 100498000 XenbaseID:XB-GENE-485101 Length:376 Species:Xenopus tropicalis


Alignment Length:313 Identity:100/313 - (31%)
Similarity:162/313 - (51%) Gaps:29/313 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RKDAATNSEMSKHDQKIPP-----------------KEFKRPSADGGPRPPPSRYIQTSEDNKDS 54
            |..::.|.|.:|:|.|:..                 ...:....|.|.:|...|           
 Frog    40 RSRSSQNRESAKNDTKVSAVVDVDDVVGSDAETEIMALLETSQKDDGVKPAGFR----------- 93

  Fly    55 TFEKVAIGICWFLVIITFPFSMCCCLTIVPEYSRMIILRLGRLRKG-LRGPGLVFILPCIDETHR 118
            .||.:.|..|..|||:|.|.|:..|:.:|.||.|.:|.||||:..| .|||||.|.|||:|:.|:
 Frog    94 VFEGLLIFCCLLLVILTLPLSIWFCVKVVREYERAVIFRLGRMLSGRARGPGLFFYLPCLDKCHK 158

  Fly   119 VDMRTDVTNVRPQDVLTKDSVTITVNAVVYYCIYSPIDSIIQVDDAKQATQLISQVTLRNIVGSK 183
            ||.|.....|....::|||.||:.::.:.||.:.:....:..|.....|.||:.|.|.:.::..:
 Frog   159 VDFRLKTFEVPFHQIVTKDLVTLEIDVICYYRLENACLFLTSVSSISSAFQLLVQTTTKRLLAHR 223

  Fly   184 TLNVLLTSRQQLSREIQQAVAGITYRWGVRVERVDVMDITLPTSLERSLASEAEAVREARAKIIL 248
            ....:|..|:.:..|::.|:...|..||::|||.::.|:.||..:::|:|.||||.|.|:.|:|.
 Frog   224 AFLDILLERKSIGEEVKVALDAATCHWGIKVERTEIKDVKLPEEVKQSMAVEAEAQRHAKVKVIA 288

  Fly   249 AEGELKASKALKEASDVMSENKITLQLRHLQILSSIASERRVRIIYPIPLEIM 301
            ||||...|:.:|.|::.:|.:...:|||:|..|..:.||:....:.|:|.::|
 Frog   289 AEGEKTVSEYIKLAAEKLSGSPTAIQLRYLHTLQCMTSEKPATFVLPLPFDLM 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 50/147 (34%)
SPFH_like 100..305 CDD:302763 70/203 (34%)
nphs2XP_017949096.1 SPFH_podocin 116..338 CDD:259809 78/221 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.