DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and STOML1

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_004800.2 Gene:STOML1 / 9399 HGNCID:14560 Length:398 Species:Homo sapiens


Alignment Length:276 Identity:82/276 - (29%)
Similarity:137/276 - (49%) Gaps:37/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FVSWILVLILLPFSLCCCLTIAYEFHRLVIFRLGRIRSCLGPGLVFLLPCIDSFNTVDIRTDVVN 98
            |:.::|:|:..|.|....|.|...:.|:::|||||||:..|||:|.|||.||||..||:||...|
Human    61 FLGFLLLLVTFPISGWFALKIVPTYERMIVFRLGRIRTPQGPGMVLLLPFIDSFQRVDLRTRAFN 125

  Fly    99 VDPQEMLTKDSVSITVNAVVFYCIYDPINSIIKVDDARDATERISQVTLRNIVGSKGLHELLASR 163
            |.|.::.:||...::|.|.|.:.|:||:.|::.|.|...||...:|..:...:..:.|.|:...:
Human   126 VPPCKLASKDGAVLSVGADVQFRIWDPVLSVMTVKDLNTATRMTAQNAMTKALLKRPLREIQMEK 190

  Fly   164 QQLSLEIQQAVAKITERWGVRVERVDL-MEI------------SLPSSLER-----------SLA 204
            .::|.::...:..:|..||:.|:||:| :|.            :|.|:|::           |:|
Human   191 LKISDQLLLEINDVTRAWGLEVDRVELAVEAVLQPPQDSPAGPNLDSTLQQLALHFLGGSMNSMA 255

  Fly   205 SEAEATREARAKIILAEGEAKASK--ALKECSDVMSENQITLQLRHLQILCSMASERRV------ 261
            ..|.:...|....:::|.|..|.:  |.......::|..:|.    ||...|.|...:|      
Human   256 GGAPSPGPADTVEMVSEVEPPAPQVGARSSPKQPLAEGLLTA----LQPFLSEALVSQVGACYQF 316

  Fly   262 NVLFPIPLEIMAPFMD 277
            ||:.|...: .|.|:|
Human   317 NVVLPSGTQ-SAYFLD 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 57/177 (32%)
SPFH_like 74..276 CDD:302763 65/233 (28%)
STOML1NP_004800.2 Tyrosine-type lysosomal sorting signal. /evidence=ECO:0000255, ECO:0000269|PubMed:19696025 6..10
PHB 77..217 CDD:214581 51/139 (37%)
SPFH_SLP-1 94..224 CDD:259814 47/129 (36%)
SCP2 304..395 CDD:280250 8/29 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.